KDM8 Fragment MS Protein Standard

Product Information
Protein Name
Lysine-specific demethylase 8
Symbol
KDM8
Synonyms
JmjC domain-containing protein 5, Jumonji domain-containing protein 5
Uniprot ID
Q8N371
Description
KDM8 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human KDM8 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.
Product Sequence
LHRPSLQHFREQFLVPGRPVILKGVADHWPCMQKWSLEYIQEIAGCRTVPVEVGSRYTDEEWSQTLMTVNEFISKYIVNEPRDVGYLA

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!

* This product is For Research Use Only. Do Not use in diagnostic or therapeutic procedures.
Related Products
Copyright © 2021 Creative Proteomics. All rights reserved.
2
Inquiry Basket