CMTR2 Fragment MS Protein Standard

Cap-specific mRNA (nucleoside-2-O-)-methyltransferase 2

CMTR2 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human CMTR2 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

CMTR2

Cap methyltransferase 2, Cap2 2O-ribose methyltransferase 2, FtsJ methyltransferase domain-containing protein 1, Protein adrift homolog

Q8IYT2

DKVAKGYFNSWAEEHGVYHPGQSSILEGTASNLECHLWHILEGKKLPKVKCSPFCNGEILKTLNEAIEKSLGGAFNLDSKFRPKQQYSCSCH