FAM20C Fragment MS Protein Standard

Extracellular serine/threonine protein kinase FAM20C

FAM20C Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human FAM20C protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

FAM20C

Dentin matrix protein 4, Golgi-enriched fraction casein kinase, Protein FAM20C

Q8IXL6

VNSDTRLSPKAAENPDWPHAGAEGAEFLSPGEAAVDSYPNWLKFHIGINRYELYSRHNPAIEALLHDLSSQRITSVAMKSGGTQLKLIM