LRRC8A Fragment MS Protein Standard

Product Information
Protein Name
Volume-regulated anion channel subunit LRRC8A
Description
LRRC8A Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human LRRC8A protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.
Symbol
LRRC8A
Synonyms
Leucine-rich repeat-containing protein 8A, Swelling protein 1
Uniprot ID
Q8IWT6
Product Sequence
ICLPCKWVTKDSCNDSFRGWAAPGPEPTYPNSTILPTPDTGPTGIKYDLDRHQYNYVDAVCYENRLHWFAK

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!

* This product is For Research Use Only. Do Not use in diagnostic or therapeutic procedures.
Related Products
Copyright © 2024 Creative Proteomics. All rights reserved.
2
Inquiry Basket