FBXO11 Fragment MS Protein Standard

F-box only protein 11

FBXO11 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human FBXO11 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

FBXO11

Protein arginine N-methyltransferase 9, Vitiligo-associated protein 1

Q86XK2

GHRAKRARVSGKSQDLSAAPAEQYLQEKLPDEVVLKIFSYLLEQDLCRAACVCKRFSELANDPILWKRLYMEVFEYTRPMMHPEPGKFYQINPEEYEHPNPWK