DCXR Fragment MS Protein Standard

Product Information
Protein Name
L-xylulose reductase
Symbol
DCXR
Synonyms
Carbonyl reductase II, Dicarbonyl/L-xylulose reductase, Kidney dicarbonyl reductase, Sperm surface protein P34H
Uniprot ID
Q7Z4W1
Description
DCXR Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human DCXR protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.
Product Sequence
IRVNAVNPTVVMTSMGQATWSDPHKAKTMLNRIPLGKFAEVEHVVNAILFLLSDRSGMTTGSTLPVEG

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!

* This product is For Research Use Only. Do Not use in diagnostic or therapeutic procedures.
Related Products
Copyright © 2021 Creative Proteomics. All rights reserved.
2
Inquiry Basket