LPPR4 Fragment MS Protein Standard

Lipid phosphate phosphatase-related protein type 4

LPPR4 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human LPPR4 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

LPPR4

Brain-specific phosphatidic acid phosphatase-like protein 1, Plasticity-related gene 1 protein

Q7Z2D5

QRAGSSGGRGECDISGAGRLGLEEAARLSCAVHTSPGGGRRPGQAAGMSAKERPKGKVIKDSVTL