TAOK1 Fragment MS Protein Standard

Product Information
Protein Name
Serine/threonine-protein kinase TAO1
Symbol
TAOK1
Synonyms
Kinase from chicken homolog B, MARK Kinase, Prostate-derived sterile 20-like kinase 2, Thousand and one amino acid protein kinase 1
Uniprot ID
Q7L7X3
Description
TAOK1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human TAOK1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.
Product Sequence
LSPEAFSHSYPGASGWSHNPTGGPGPHWGHPMGGPPQAWGHPMQGGPQPWGHPSGPMQGVPRGSSMGVRNSPQALRRTASGGRTEQGMSRSTSVTSQISNGSH

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!

Related Products
Copyright © 2021 Creative Proteomics. All rights reserved.
2
Inquiry Basket