MED25 Fragment MS Protein Standard

Mediator of RNA polymerase II transcription subunit 25

MED25 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human MED25 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

MED25

Activator interaction domain-containing protein 1, Activator-recruited cofactor 92 kDa component, Mediator complex subunit 25, p78

Q71SY5

SLVVFNTVDCAPESYVQCHAPTSSAYEFVTWLDGIKFMGGGGESCSLIAEGLSTALQLFDDFKKMREQIGQTHRVCLLIC