RAPH1 Fragment MS Protein Standard

Ras-associated and pleckstrin homology domains-containing protein 1

RAPH1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human RAPH1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

RAPH1

Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 18 protein, Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 9 protein, Lamellipodin, Proline-rich EVH1 ligand 2, Protein RMO1

Q70E73

QLSDEEIDHGAEEDSDKEDQDLDKMFGAWLGELDKLTQSLDSDKPMEPVKRSPLRQETNMANFSYRFSIYNLN