TBC1D9 Fragment MS Protein Standard

TBC1 domain family member 9

TBC1D9 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human TBC1D9 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

TBC1D9

TBC1 domain family member 9A

Q6ZT07

VGKLFVAQPAKEGGSGGSGPSCHQGIPGVLFPKKGPGQPYVVESVEPLPASLAPDSEEHSLGGQMEDIKLEDSSPRDNGACSSMLISDDDTK

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!