PPP1R21 Fragment MS Protein Standard

Protein phosphatase 1 regulatory subunit 21

PPP1R21 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human PPP1R21 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

PPP1R21

Coiled-coil domain-containing protein 128, KLRAQ motif-containing protein 1

Q6ZMI0

LTRKYMETIEKLQNDKAKLEVKSQTLEKEAKECRLRTEECQLQLKTLHEDLSGRLEESLSIINEKVPFNDTKYSQYNALNVPLHNR