DSTYK Fragment MS Protein Standard

Dual serine/threonine and tyrosine protein kinase

DSTYK Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human DSTYK protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

DSTYK

Dusty protein kinase, RIP-homologous kinase, Receptor-interacting serine/threonine-protein kinase 5, Sugen kinase 496

Q6XUX3

KENELYESLMNIANRKQEEMKDMIVETLNTMKEELLDDATNMEFKDVIVPENGEPVGTREIKCCIRQIQELIISRLNQAVANK