LINGO4 Fragment MS Protein Standard

Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 4

LINGO4 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human LINGO4 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

LINGO4

Leucine-rich repeat neuronal protein 6D

Q6UY18

HGLQSLLTLRLQGNRLRIMGPGVFSGLSALTLLDLRLNQIVLFLDGAFGELGSLQKLEVG