FAM198B Fragment MS Protein Standard

Protein FAM198B

FAM198B Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human FAM198B protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

FAM198B

Expressed in nerve and epithelium during development

Q6UWH4

DTNCCGFRPRKEDACVQNGLRPKCDDQGSAALAHIIQRKHDPRHLVFIDNKGFFDRSEDNLNFKLLEGIKEFPASAVSVLKSQHLRQKLLQSLFLDK

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!