KCNT2 Fragment MS Protein Standard

Potassium channel subfamily T member 2

KCNT2 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human KCNT2 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

KCNT2

Sequence like an intermediate conductance potassium channel subunit, Sodium and chloride-activated ATP-sensitive potassium channel Slo2.1

Q6UVM3

GIYRTESQKLTTSESQISISVEEWEDTKDSKEQGHHRSNHRNSTSSDQSDHPLLRR