SARM1 Fragment MS Protein Standard

Sterile alpha and TIR motif-containing protein 1

SARM1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human SARM1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

SARM1

Sterile alpha and Armadillo repeat protein, Sterile alpha motif domain-containing protein 2, Tir-1 homolog

Q6SZW1

NFVLVLSPGALDKCMQDHDCKDWVHKEIVTALSCGKNIVPIIDGFEWPEPQVLPEDMQAVLTFNGIKWSHEYQEATIEKIIR