TAF2 Fragment MS Protein Standard

Product Information
Protein Name
Transcription initiation factor TFIID subunit 2
Description
TAF2 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human TAF2 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.
Symbol
TAF2
Synonyms
150 kDa cofactor of initiator function, RNA polymerase II TBP-associated factor subunit B, TBP-associated factor 150 kDa, Transcription initiation factor TFIID 150 kDa subunit
Uniprot ID
Q6P1X5
Product Sequence
ISMEFMLQVFNKLLSLASTASSQKFQSHMWSQMLVSTSGFLKSISNVSGKDIQPLIKQWVDQSGVVKFYGSFAFNRKR

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!

* This product is For Research Use Only. Do Not use in diagnostic or therapeutic procedures.
Related Products
2
Inquiry Basket