ZCCHC8 Fragment MS Protein Standard

Zinc finger CCHC domain-containing protein 8

ZCCHC8 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human ZCCHC8 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

ZCCHC8

TRAMP-like complex RNA-binding factor ZCCHC8

Q6NZY4

PGWLKEAELENSGLALYDGKDGTDGETEVGEIQQNKSVTYDLSKLVNYPGFNISTPRGIPDEWRIFGSIPMQACQQK