SLC8B1 Fragment MS Protein Standard

Sodium/potassium/calcium exchanger 6, mitochondrial

SLC8B1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human SLC8B1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

SLC8B1

Na(+)/K(+)/Ca(2+)-exchange protein 6, Sodium/calcium exchanger protein, mitochondrial, Solute carrier family 24 member 6, Solute carrier family 8 member B1

Q6J4K2

RQRRGSLFCPMPVTPEILSDSEEDRVSSNTNSYDYGDEYRPLFFYQETTAQILVRALNPLDYMKWRRKSAYWKAL