GPR139 Fragment MS Protein Standard

Probable G-protein coupled receptor 139

GPR139 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human GPR139 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

GPR139

G(q)-coupled orphan receptor GPRg1, G-protein-coupled receptor PGR3

Q6DWJ6

ISKRFRTMAAATLKAFFKCQKQPVQFYTNHNFSITSSPWISPANSHCIKMLVYQYDK