TPRG1L Fragment MS Protein Standard

Tumor protein p63-regulated gene 1-like protein

TPRG1L Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human TPRG1L protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

TPRG1L

Mossy fiber terminal-associated vertebrate-specific presynaptic protein, Protein FAM79A

Q5T0D9

TEHPMAGADEKTASLCQLESFKALLIQAVKKAQKESPLPGQANGVLILERPLLIETY