PERM1 Fragment MS Protein Standard

PGC-1 and ERR-induced regulator in muscle protein 1

PERM1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human PERM1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

PERM1

PPARGC1 and ESRR-induced regulator in muscle 1, Peroxisome proliferator-activated receptor gamma coactivator 1 and estrogen-related receptor-induced regulator in muscle 1

Q5SV97

PVQEDRPGPGLGLSTPVPVTEQGTDQIRTPRRAKLHTVSTTVWEALPDVSRAKSDMAVSTPASEPQPDRDMAVSTPASEPQSDRDMAVSTPASEPQPD