PPM1L Fragment MS Protein Standard

Protein phosphatase 1L

PPM1L Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human PPM1L protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

PPM1L

Protein phosphatase 1-like, Protein phosphatase 2C isoform epsilon

Q5SGD2

AEYVKSRLPEALKQHLQDYEKDKENSVLSYQTILEQQILSIDREMLEKLTVSYDEAGTTCLIALLSDKDLTVANVGDS