CLEC12A Fragment MS Protein Standard

C-type lectin domain family 12 member A

CLEC12A Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human CLEC12A protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

CLEC12A

C-type lectin-like molecule 1, Dendritic cell-associated lectin 2, Myeloid inhibitory C-type lectin-like receptor

Q5QGZ9

TTLQTIATKLCRELYSKEQEHKCKPCPRRWIWHKDSCYFLSDDVQTWQESKMACAAQNASLLKINNKNALEFIKSQSRSYDYWLGLSPEEDSTRGMRVDNIINSSAWVIRN