RALGPS1 Fragment MS Protein Standard

Ras-specific guanine nucleotide-releasing factor RalGPS1

RALGPS1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human RALGPS1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

RALGPS1

Ral GEF with PH domain and SH3-binding motif 1, Ral guanine nucleotide exchange factor 2, RalA exchange factor RalGPS1

Q5JS13

NMMCQLSVVESKSATFPSEKARHLLDDSVLESRSPRRGLALTSSSAVTNGLSLGSSESSEFSEEMSSGLES