CFAP221 Fragment MS Protein Standard

Cilia- and flagella-associated protein 221

CFAP221 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human CFAP221 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

CFAP221

Primary ciliary dyskinesia protein 1

Q4G0U5

SVSPKEVLPFAFPDCSPPQDSNELAPDGLGLVPIKSSEVQIKQSYSFFNLQVPQLYKIKRYQPFSVHKSSTSYRPQKLARALKQGAEDEVTTITALPKQDSTT