RIC1 Fragment MS Protein Standard

RAB6A-GEF complex partner protein 1

RIC1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human RIC1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

RIC1

Connexin-43-interacting protein of 150 kDa, Protein RIC1 homolog

Q4ADV7

YCATLDGFAVVFNDGKVGFITPVSSRFTAEQLHGVWPQDVVDGTCVAVNNKYRLMAFGCVSGSVQVYTIDNSTGAMLLSHKLELTAKQYPD