CHD9 Fragment MS Protein Standard

Chromodomain-helicase-DNA-binding protein 9

CHD9 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human CHD9 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

CHD9

ATP-dependent helicase CHD9, Chromatin-related mesenchymal modulator, Chromatin-remodeling factor CHROM1, Kismet homolog 2, PPAR-alpha-interacting complex protein 320 kDa, Peroxisomal proliferator-activated receptor A-interacting complex 320 kDa protein

Q3L8U1

SLRSQQNRNNLNPGQNSLSQSKNFMNVSGPHRVNVNHPPQMTNASNSQQSISMQQFSQTSNPSAHFHKCSSHQEGNFNGPSPNMTSCSVSNSQQFSSHYSFSSNHISPNSLLQSSA