LETM2 Fragment MS Protein Standard

LETM1 domain-containing protein LETM2, mitochondrial

LETM2 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human LETM2 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

LETM2

LETM1 and EF-hand domain-containing protein 2, Leucine zipper-EF-hand-containing transmembrane protein 1-like

Q2VYF4

MKNYESKKYSDPSQPGNTVLHPGTRLIQKLHTSTCWLQEVPGKPQLEQATKHPQVTSPQATKETGMEIKEGKQSYRQKIMDELKYYYNGF