ST3GAL2 Fragment MS Protein Standard

CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2

ST3GAL2 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human ST3GAL2 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

ST3GAL2

Gal-NAc6S, Gal-beta-1,3-GalNAc-alpha-2,3-sialyltransferase, ST3Gal II, ST3GalA.2, Sialyltransferase 4B

Q16842

THHFMYPESAKNLPANVSFVLVPFKVLDLLWIASALSTGQIRFTYAPVKSFLRVDKEKVQIYNPAFFKYIHD