ASIC2 Fragment MS Protein Standard

Acid-sensing ion channel 2

ASIC2 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human ASIC2 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

ASIC2

Amiloride-sensitive brain sodium channel, Amiloride-sensitive cation channel 1, neuronal, Amiloride-sensitive cation channel neuronal 1, Brain sodium channel 1, Mammalian degenerin homolog

Q16515

MDLKESPSEGSLQPSSIQIFANTSTLHGIRHIFVYGPLTIRR