NCOA1 Fragment MS Protein Standard

Nuclear receptor coactivator 1

NCOA1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human NCOA1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

NCOA1

Class E basic helix-loop-helix protein 74, Protein Hin-2, RIP160, Renal carcinoma antigen NY-REN-52, Steroid receptor coactivator 1

Q15788

NLSLDDVKVKVEKKEQMDPCNTNPTPMTKPTPEEIKLEAQSQFTADLDQFDQLLPTLEKAAQLPGLCETDRMDGAVTSVTIKSEILPAS