EFNB3 Fragment MS Protein Standard

Ephrin-B3

EFNB3 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human EFNB3 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

EFNB3

EPH-related receptor transmembrane ligand ELK-L3, EPH-related receptor tyrosine kinase ligand 8

Q15768

HSSPNYEFYKLYLVGGAQGRRCEAPPAPNLLLTCDRPDLDLRFTIKFQEYSPNLWGHEFRSHHDYYIIATSDGTREGLESLQGGVCLTRGMKVLLRVGQSPRGGAVPRKPVSEMPMERDRGAAHSLEPGKENLPGDPTSNATS