SLC9A3R2 Fragment MS Protein Standard

Product Information
Protein Name
Na(+)/H(+) exchange regulatory cofactor NHE-RF2
Description
SLC9A3R2 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human SLC9A3R2 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.
Symbol
SLC9A3R2
Synonyms
NHE3 kinase A regulatory protein E3KARP, SRY-interacting protein 1, Sodium-hydrogen exchanger regulatory factor 2, Solute carrier family 9 isoform A3 regulatory factor 2, Tyrosine kinase activator protein 1
Uniprot ID
Q15599
Product Sequence
RLVEVNGVNVEGETHHQVVQRIKAVEGQTRLLVVDQETDEELRRRQLTCTEEMAQRGLPPAHDPWEPKPDWAHTGSHSSEAGKKDVSGPLRELRPRLCHLRKGPQGYGFNLH

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!

* This product is For Research Use Only. Do Not use in diagnostic or therapeutic procedures.
Related Products
Copyright © 2024 Creative Proteomics. All rights reserved.
2
Inquiry Basket