TAF1C Fragment MS Protein Standard

TATA box-binding protein-associated factor RNA polymerase I subunit C

TAF1C Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human TAF1C protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

TAF1C

RNA polymerase I-specific TBP-associated factor 110 kDa, TATA box-binding protein-associated factor 1C, Transcription initiation factor SL1/TIF-IB subunit C

Q15572

GGCRYRKRPRVVLDVTEQISRFLLDHGDVAFAPLGKLMLENFKLEGAGSRTKKKTVVSVKKLLQDLGGHQPWGCPWAYLSNRQR