SF3B4 Fragment MS Protein Standard

Splicing factor 3B subunit 4

SF3B4 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human SF3B4 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

SF3B4

Pre-mRNA-splicing factor SF3b 49 kDa subunit, SF3b50, Spliceosome-associated protein 49

Q15427

IRVNKASAHNKNLDVGANIFIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFASFDASDAAIEAMNGQYLCNRPITV