SLMAP Fragment MS Protein Standard

Sarcolemmal membrane-associated protein

SLMAP Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human SLMAP protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

SLMAP

TATA box-binding protein-associated factor 2S, Transcription factor CA150

Q14BN4

SEYEKEITSLQNSFQLRCQQCEDQQREEATRLQGELEKLRKEWNALETECHSLKRENVLLSSELQRQEKELHNSQKQSLELTSDLSILQMSRKELENQVGSLKEQHLRDSADLKTLLSKAENQAKDVQKEYEKTQTVLSELKLKFEMTEQ