COG2 Fragment MS Protein Standard

Conserved oligomeric Golgi complex subunit 2

COG2 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human COG2 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

COG2

Component of oligomeric Golgi complex 2, Low density lipoprotein receptor defect C-complementing protein

Q14746

VPTTASSYVDSALKPLFQLQSGHKDKLKQAIIQQWLEGTLSESTHKYYETVSDVLNSVKKMEESLKRLKQARKTTPANPVGPSGGMSDDD