SLC29A2 Fragment MS Protein Standard

Product Information
Protein Name
Equilibrative nucleoside transporter 2
Description
SLC29A2 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human SLC29A2 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.
Symbol
SLC29A2
Synonyms
36 kDa nucleolar protein HNP36, Delayed-early response protein 12, Equilibrative nitrobenzylmercaptopurine riboside-insensitive nucleoside transporter, Hydrophobic nucleolar protein, 36 kDa, Nucleoside transporter, ei-type, Solute carrier family 29 member
Uniprot ID
Q14542
Product Sequence
KFARYYLANKSSQAQAQELETKAELLQSDENGIPSSPQKVALTLDLDLEKEPESEPDEPQKPGKPSVFTVFQK

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!

* This product is For Research Use Only. Do Not use in diagnostic or therapeutic procedures.
Related Products
Copyright © 2024 Creative Proteomics. All rights reserved.
2
Inquiry Basket