KRR1 Fragment MS Protein Standard

KRR1 small subunit processome component homolog

KRR1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human KRR1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

KRR1

HIV-1 Rev-binding protein 2, KRR-R motif-containing protein 1, Rev-interacting protein 1

Q13601

LKANQKKRQKMEAIKAKQAEAISKRQEERNKAFIPPKEKPIVKPKEASTETKIDVASIKEKVKKAKNKKLGALTAEEIALKMEAD