SP140 Fragment MS Protein Standard

Nuclear body protein SP140

SP140 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human SP140 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

SP140

Lymphoid-restricted homolog of Sp100, Nuclear autoantigen Sp-140, Speckled 140 kDa

Q13342

SELEKTFGWSHLEALFSRINLMAYPDLNEIYRSFQNVCYEHSPLQMNNVNDLEDRPRLLPYGKQENSNACHEMDDIAVPQEALSSSPRCEPGFSSESCEQLALPKAGGGDAEDAPSLLPGGGVSCKLAIQIDEGESEEMPKLLP