G3BP1 Fragment MS Protein Standard

Ras GTPase-activating protein-binding protein 1

G3BP1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human G3BP1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

G3BP1

ATP-dependent DNA helicase VIII, GAP SH3 domain-binding protein 1

Q13283

PHVVKVPASQPRPESKPESQIPPQRPQRDQRVREQRINIPPQRGPRPIREAGEQGDIEPRRMVRHPD