SLC10A2 Fragment MS Protein Standard

Ileal sodium/bile acid cotransporter

SLC10A2 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human SLC10A2 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

SLC10A2

Apical sodium-dependent bile acid transporter, Ileal Na(+)/bile acid cotransporter, Ileal sodium-dependent bile acid transporter, Na(+)-dependent ileal bile acid transporter, Sodium/taurocholate cotransporting polypeptide, ileal, Solute carrier family 10

Q12908

NKAEIPESKENGTEPESSFYKANGGFQPDE