MAP4K2 Fragment MS Protein Standard

Mitogen-activated protein kinase kinase kinase kinase 2

MAP4K2 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human MAP4K2 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

MAP4K2

B lymphocyte serine/threonine-protein kinase, Germinal center kinase, MAPK/ERK kinase kinase kinase 2, Rab8-interacting protein

Q12851

ETDPLNEPWEEEWTLLGKEELSGSLLQSVQEALEERSLTIRSASEFQELDSPDDTMGTIKRAPFLGPLPTDPPAEEPLSSPPGTLPPPPSGPNSSPLLPTAWATMKQRE