NIPAL4 Fragment MS Protein Standard

Magnesium transporter NIPA4

NIPAL4 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human NIPAL4 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

NIPAL4

Ichthyin, NIPA-like protein 4, Non-imprinted in Prader-Willi/Angelman syndrome region protein 4

Q0D2K0

FKDLDISCASLPHMHKNPPPSPAPEPTVIRLEDKNVLVDNIELASTSSPEEKPKVFIIHS