WT1-AS Fragment MS Protein Standard

Putative Wilms tumor upstream neighbor 1 gene protein

WT1-AS Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human WT1-AS protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

WT1-AS

Wilms tumor-associated antisense RNA

Q06250

MQRRGQPLENHVALIHWQSAGIPASKVHNYCNMKKSRLGRSRAVRISQPLLSPRRCPLHLTERGAGLLQPQPQGPVRTPGPPSGSHP