SRSF11 Fragment MS Protein Standard

Serine/arginine-rich splicing factor 11

SRSF11 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human SRSF11 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

SRSF11

Arginine-rich 54 kDa nuclear protein, Splicing factor, arginine/serine-rich 11

Q05519

LLPTPNPLTQIGAVPLAALGAPTLDPALAALGLPGANLNSQSLAADQLLKLMSTVDPKLNHVAAGLVSPSLKSDTSSKEIEEAMKRVREAQSLISAAIEPDKKEEKRRHSRSRSR