MAP3K10 Fragment MS Protein Standard

Mitogen-activated protein kinase kinase kinase 10

MAP3K10 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human MAP3K10 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

MAP3K10

Mixed lineage kinase 2, Protein kinase MST

Q02779

LPSGFEHKITVQASPTLDKRKGSDGASPPASPSIIPRLRAIRLTPVDCGGSSSGSSSGGSGTWSRGGPPKKEELVGGKKKGRTWGPSSTLQKERVGGEERLKGLGEGSKQWSSS