CYP4F2 Fragment MS Protein Standard

Product Information
Protein Name
Phylloquinone omega-hydroxylase CYP4F2
Description
CYP4F2 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human CYP4F2 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.
Symbol
CYP4F2
Synonyms
20-hydroxyeicosatetraenoic acid synthase, Arachidonic acid omega-hydroxylase, CYPIVF2, Cytochrome P450 4F2, Cytochrome P450-LTB-omega, Leukotriene-B(4) 20-monooxygenase 1, Leukotriene-B(4) omega-hydroxylase 1
Uniprot ID
P78329
Product Sequence
RRNWFWGHQGMVNPTEEGMRVLTQLVATYPQGFKVWMGPISPLLSLCHPD

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!

* This product is For Research Use Only. Do Not use in diagnostic or therapeutic procedures.
Related Products
Copyright © 2024 Creative Proteomics. All rights reserved.
2
Inquiry Basket